This is a working overview of GLP-1 receptor, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-05-29 and is reviewed periodically as new material appears.
Semaglutide is a synthetic peptide that acts as an agonist at the glucagon-like peptide-1 receptor. It is a structural analogue of human GLP-1(7-37), modified to resist enzymatic degradation by dipeptidyl peptidase-4. The peptide backbone contains alpha-aminoisobutyric acid at position 8, a substitution that stabilises the helix and slows cleavage. A fatty diacid side chain attached through a linker at lysine 34 promotes binding to serum albumin, which extends the circulating half-life. These two modifications together allow less frequent administration than native GLP-1 requires.
Activation of the GLP-1 receptor couples to Gs signalling and raises intracellular cyclic AMP in pancreatic beta cells. The resulting insulin release depends on prevailing glucose concentrations, so the effect is greater when glucose is elevated. Receptor engagement also suppresses glucagon secretion and slows gastric emptying, which flattens post-meal glucose excursions. In the central nervous system, signalling in hypothalamic and brainstem regions is associated with reduced appetite and lower energy intake. Studies continue to examine effects on cardiac, renal and hepatic endpoints; whether those benefits are independent of weight change remains an open question.
Semaglutide is a synthetic peptide analog of glucagon-like peptide-1, a hormone released from intestinal L-cells after food intake. It contains 31 amino acids and differs from native GLP-1 through modifications that slow enzymatic breakdown. The peptide was developed to extend the short circulating half-life of endogenous GLP-1, which is measured in minutes. Researchers introduced the compound in the early 2010s. Two backbone changes and a fatty acid side chain define its structure, distinguishing it from earlier GLP-1 receptor agonists.
The compound binds the GLP-1 receptor on pancreatic beta cells and other tissues, activating a G-protein signaling cascade that raises intracellular cyclic AMP. This action increases glucose-dependent insulin secretion when blood glucose is elevated, while binding also slows gastric emptying and reduces glucagon release. In the central nervous system, receptor activation in the hypothalamus and brainstem contributes to reduced appetite. The fatty acid chain binds albumin, which protects the peptide from renal filtration and enzymatic degradation. This albumin binding is central to its extended circulation time.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C187H291N45O59 | Parent peptide; salt forms also reported |
| Molecular mass | about 4113.6 Da | Average mass of the free peptide |
| Peptide length | 31 amino acids | Backbone related to GLP-1(7-37) |
| Key substitution | Aib at position 8 | Blocks DPP-4 cleavage |
| Albumin binding | Via C-18 diacid side chain | Prolongs circulation time |
Reported molecular weight is approximately 4113.6 daltons for the free base, and the peptide is supplied as a lyophilized powder or in buffered liquid form depending on the intended use. It is freely soluble in water when formulated with appropriate excipients, though the unconjugated peptide shows limited stability at neutral pH over long periods. Analytical characterization typically relies on reversed-phase high-performance liquid chromatography and mass spectrometry. Purity specifications for research-grade material commonly exceed ninety-five percent by area. Isotopic and impurity profiles differ between suppliers.
Two principal therapeutic variants exist under separate regulatory filings, one indicated for glycemic control in type 2 diabetes and one for chronic weight management. Both use the same active molecule; differences lie in formulation strength, titration schedule, and labeling. Regulatory agencies in the United States and European Union approved injectable forms in 2017 and 2018 respectively. An oral tablet formulation received approval later, using a carrier molecule to enhance absorption across the gastric epithelium. Labeling differs by jurisdiction and by indication.
As a peptide, semaglutide is sensitive to conditions that break amide bonds or modify side chains. Deamidation of asparagine and glutamine residues, oxidation of methionine and tryptophan, and non-covalent aggregation are the main degradation routes described in published stability work. Rate depends strongly on pH, buffer species, ionic strength, temperature and exposure to light. Formulators therefore choose a defined solution pH and often add excipients such as phosphate buffer, propylene glycol and phenol, each of which plays a separate role in pH control, tonicity or preservation.
Storage guidance for the finished injectable product distinguishes the unused state from the in-use state. Before first use, pens are kept refrigerated between 2 and 8 degrees Celsius, protected from light, and never frozen, since freezing can disrupt the peptide or the device. After first use, label instructions in several markets permit storage at room temperature up to about 30 degrees Celsius for a limited number of days. Solid research-grade material is normally held at or below minus 20 degrees Celsius, often with desiccant, and allowed to equilibrate before opening.
Quantification and purity assessment rely on separation methods coupled to optical or mass detection. Reversed-phase high-performance liquid chromatography resolves the intact peptide from related impurities and is the standard assay technique. Size-exclusion chromatography measures aggregates, while ion-exchange chromatography separates charge variants produced by deamidation. Mass spectrometry confirms identity and detects mass shifts of a few daltons. In biological matrices, liquid chromatography with tandem mass spectrometry is often used because immunoassays can cross-react with endogenous GLP-1 or with circulating fragments.
=== Contamination scare === In August 2013, China temporarily suspended all milk powder imports from New Zealand, after a scare where botulism-causing bacteria were falsely detected in several batches of New Zealand-produced whey protein concentrate. As a result of the product recall, the New Zealand dollar slipped by 0.8% (to 77.78 US cents) based on expected losses in sales from this single commodity.
=== Respiration === Cephalopods exchange gases with the seawater by forcing water through their gills, which are attached to the roof of the organism. Water enters the mantle cavity on the outside of the gills, and the entrance of the mantle cavity closes. When the mantle contracts, water is forced through the gills, which lie between the mantle cavity and the funnel. The water's expulsion through the funnel is used to power jet propulsion. If respiration is used concurrently with jet propulsion, large losses in speed or oxygen generation can be expected. The gills, which are much more efficient than those of other mollusks, are attached to the ventral surface of the mantle cavity. There is a trade-off with gill size regarding lifestyle. To achieve fast speeds, gills need to be small – water will be passed through them quickly when energy is needed, compensating for their small size. However, organisms which spend most of their time moving slowly along the bottom do not naturally pass much water through their cavity for locomotion; thus they have larger gills, along with complex systems to ensure that water is constantly washing through their gills, even when the organism is stationary. The water flow is controlled by contractions of the radial and circular mantle cavity muscles. The gills of cephalopods are supported by a skeleton of robust fibrous proteins; the lack of mucopolysaccharides distinguishes this matrix from cartilage. The gills are also thought to be involved in excretion, with NH4+ being swapped with K+ from the seawater.
In severe IRIS, symptoms may cause permanent disability or death. Management again includes antimicrobial treatments against the underlying infection. Corticosteroids are the most commonly used intervention in these cases as they work to suppress the inflammatory response seen in IRIS, though there is limited research on their efficacy. Guidelines recommend a risk/benefit analysis prior to starting corticosteroids, especially taking into consideration the patient's comorbidities. Common adverse effects of corticosteroids are hyperglycemia, hypertension, mental status changes, worsening of an existing infection, and increased risk of a new infection. Important exceptions include cases of Cryptococcal-IRIS with worsening meningitis symptoms (cranial nerve defects, hearing or vision changes) and cases of Kaposi's sarcoma. In these cases, corticosteroids should not be used as they have been shown to worsen outcomes. It is recommended to continue ART except in the most severe cases of IRIS. Discontinuing ART may be considered in life-threatening cases of IRIS not improved by corticosteroids, usually in central nervous system-associated IRIS. Stopping ART increases the risk of acquiring new OI and developing IRIS again when restarting ART.
Sources: en.wikipedia.org
==== Lithium ==== The chemistry of lithium shows several differences from that of the rest of the group as the small Li+ cation polarises anions and gives its compounds a more covalent character. Lithium and magnesium have a diagonal relationship due to their similar atomic radii, so that they show some similarities. For example, lithium forms a stable nitride, a property common among all the alkaline earth metals (magnesium's group) but unique among the alkali metals. In addition, among their respective groups, only lithium and magnesium form organometallic compounds with significant covalent character (e.g. LiMe and MgMe2). Lithium fluoride is the only alkali metal halide that is poorly soluble in water, and lithium hydroxide is the only alkali metal hydroxide that is not deliquescent. Conversely, lithium perchlorate and other lithium salts with large anions that cannot be polarised are much more stable than the analogous compounds of the other alkali metals, probably because Li+ has a high solvation energy. This effect also means that most simple lithium salts are commonly encountered in hydrated form, because the anhydrous forms are extremely hygroscopic: this allows salts like lithium chloride and lithium bromide to be used in dehumidifiers and air-conditioners.
=== Kits === The modern-day interest in absinthe has spawned a rash of absinthe kits from sellers claiming they produce homemade absinthe. Kits often call for soaking herbs in vodka or alcohol or adding a liquid concentrate to vodka or alcohol to create an ersatz absinthe. Such practices usually yield a harsh substance that bears little resemblance to the genuine article and is considered inauthentic by any practical standard. Some concoctions may even be dangerous, especially if they call for a potentially poisonous inclusion of herbs, oils, or extracts. In at least one documented case, a person suffered acute kidney injury after drinking 10 ml of pure wormwood oil.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Aspartic, glutamic, and metallo-proteases activate a water molecule, which performs a nucleophilic attack on the peptide bond to hydrolyze it. Serine, threonine, and cysteine proteases use a nucleophilic residue (usually in a catalytic triad). That residue performs a nucleophilic attack to covalently link the protease to the substrate protein, releasing the first half of the product. This covalent acyl-enzyme intermediate is then hydrolyzed by activated water to complete catalysis by releasing the second half of the product and regenerating the free enzyme
Sources: en.wikipedia.org
The structure of the native state is generally assumed to be determined by its amino acid sequence (Anfinsen's dogma). This is a thermodynamic principle which states that the native structure is a unique, stable and kinetically accessible minimum of the free energy. The thermodynamic path going from unfolded to the native state is typically visualized as a free energy landscape in the form of a folding funnel. The forces driving the folding is a combination of hydrophobic interacts, hydrogen bonding, van der Waals forces and Coloumb interactions. During folding, the number hydrophobic side-chains exposed to water is minimized, which is known as hydrophobic collapse, causing them to collapse into the core of the protein. This causes most globular proteins to have hydrophilic side-chains outwards on the surface exposed to solvent and hydrophobic side-chains in the core.
Mabel Tolkien was received into the Roman Catholic Church in 1900 despite vehement protests by her Baptist family, which stopped all financial assistance to her. In 1904, when J. R. R. Tolkien was 12, his mother died of acute diabetes at Fern Cottage in Rednal, which she was renting. She was then about 34 years of age, about as old as a person with diabetes mellitus type 1 could survive without treatment—insulin would not be discovered until 1921, two decades later. Nine years after her death, Tolkien wrote, "My own dear mother was a martyr indeed, and it is not to everybody that God grants so easy a way to his great gifts as he did to Hilary and myself, giving us a mother who killed herself with labour and trouble to ensure us keeping the faith." Before her death, Mabel Tolkien had assigned the guardianship of her sons to her close friend, Father Francis Xavier Morgan of the Birmingham Oratory, who was assigned to bring them up as good Catholics. In a 1965 letter to his son Michael, Tolkien recalled the influence of the man whom he always called "Father Francis": "He was an upper-class Welsh-Spaniard Tory, and seemed to some just a pottering old gossip. He was—and he was not.
==== Relations with surrounding states ==== The major powers tried to exploit Cossack military power for their own purposes. In the 16th century, with the area of the Polish-Lithuanian Commonwealth extending south, the Zaporozhian Cossacks were mostly, if tentatively, regarded by the Commonwealth as their subjects. Foreign and internal pressure on the Polish-Lithuanian Commonwealth led to the government making concessions to the Zaporozhian Cossacks. King Stephen Báthory granted them certain rights and freedoms in 1578, and they gradually began to create their foreign policy. They did so independently of the government, and often against its interests, as for example with their role in Moldavian affairs, and with the signing of a treaty with Emperor Rudolf II in the 1590s. Registered Cossacks formed a part of the Commonwealth army until 1699.
Sources: en.wikipedia.org
It belongs to the incretin mimetic class and acts as a long-acting glucagon-like peptide-1 receptor agonist. The class includes several peptides with different half-lives and routes of administration.
The side chain enables reversible binding to albumin in the bloodstream, which protects the peptide from rapid renal clearance. This extends the interval between administrations compared with unmodified GLP-1.
No. It shares much of the native sequence but carries substitutions and an added side chain. These changes increase stability against enzymatic breakdown.
It is a synthetic analog of GLP-1 produced through medicinal chemistry to resist enzymatic degradation. The design goal was longer circulation than the native hormone.